Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IL4R protein

This Human IL4R protein spans the amino acid sequence from region 26-231aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Interleukin-4 receptor subunit alpha; IL-4 receptor subunit alpha; IL-4R subunit alpha; IL-4R-alpha; IL-4RA; CD124; IL-4-binding protein; IL4-BP; IL4R; IL4RA

UniProt

P24394

Expression Region

26-231aa

Tag

C-terminal Fc-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

1The ED50 as determined by its ability to inhibit IL-4-dependent proliferation of TF‐1 human erythroleukemic cells is 5-20 ng/ml.2Measured by its binding ability in a functional ELISA. Immobilized Human IL-4 RA-Fc at 5μg/ml can bind Human IL-4 (Biotinylated by NHS-biotin prior to testing), the ED50 of Human IL-4 is 2.43 ng/ml.

Form

Lyophilized powder

Molecular Weight

50.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Extracellular Domain

Preservative

Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4

AA Sequence

MKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Heme oxygenase 1 ELISA Kit
orb1661566 96 Tests

Rat Heme oxygenase 1 ELISA Kit

Sign In for Pricing
View Details
Rat Monoclonal TSG Antibody (RM0140-7D19) [Alexa Fluor 488]
NBP1-22516AF488 0.1 mL

Rat Monoclonal TSG Antibody (RM0140-7D19) [Alexa Fluor 488]

Sign In for Pricing
View Details
Basic Leucine Zipper ATF-Like Transcription Factor 3 (BATF3) Antibody
abx301043-01 20 µg

Basic Leucine Zipper ATF-Like Transcription Factor 3 (BATF3) Antibody

Sign In for Pricing
View Details
Basic Leucine Zipper ATF-Like Transcription Factor 3 (BATF3) Antibody
abx301043-02 50 µg

Basic Leucine Zipper ATF-Like Transcription Factor 3 (BATF3) Antibody

Sign In for Pricing
View Details
Basic Leucine Zipper ATF-Like Transcription Factor 3 (BATF3) Antibody
abx301043-03 100 µg

Basic Leucine Zipper ATF-Like Transcription Factor 3 (BATF3) Antibody

Sign In for Pricing
View Details
Basic Leucine Zipper ATF-Like Transcription Factor 3 (BATF3) Antibody
abx301043-04 200 µg

Basic Leucine Zipper ATF-Like Transcription Factor 3 (BATF3) Antibody

Sign In for Pricing
View Details