Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IL4R protein

This Human IL4R protein spans the amino acid sequence from region 26-232aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Interleukin-4 receptor subunit alpha; IL-4 receptor subunit alpha; IL-4R subunit alpha; IL-4R-alpha; IL-4RA; CD124; IL-4-binding protein; IL4-BP; IL4R; IL4RA

UniProt

P24394

Expression Region

26-232aa

Tag

C-terminal 6xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined by its ability to inhibit IL-4-dependent proliferation of TF‐1 human erythroleukemic cells is 5-20 ng/ml.

Form

Lyophilized powder

Molecular Weight

24.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Extracellular Domain

Preservative

Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4

AA Sequence

MKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TIMP3 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV793075 1.0 µg DNA

TIMP3 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Hsa-miR-5739 agomir
HY-R01795A-01 5 nmol

Hsa-miR-5739 agomir

Sign In for Pricing
View Details
Hsa-miR-5739 agomir
HY-R01795A-02 20 nmol

Hsa-miR-5739 agomir

Sign In for Pricing
View Details
Rad51 Rabbit pAb, PerCP-Cy7 conjugated
orb2851386 100 µL

Rad51 Rabbit pAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details
Mouse Monoclonal human TfR EC Antibody
orb1153156 100 µg

Mouse Monoclonal human TfR EC Antibody

Sign In for Pricing
View Details
Leptomycin B
B6907-1 1 mg

Leptomycin B

Sign In for Pricing
View Details