Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Il33 protein

This Mouse Il33 protein spans the amino acid sequence from region 109-266aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Interleukin 33; IL-33; IL33; C9orf26; NKHEV; Interleukin-1 family member 11; DVS27; NF-HEV and IL- 1F11

UniProt

Q8BVZ5

Expression Region

109-266aa

Tag

Tag-Free

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Mouse IL-33 at 5μg/ml can bind Mouse ST2-Fc, the ED50 of Mouse ST2-Fc is 0.33 ug/ml.

Form

Lyophilized powder

Molecular Weight

17.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4

AA Sequence

SIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

H-L-beta-HIle-OH Hydrochloride
sc-285955A 5 g

H-L-beta-HIle-OH Hydrochloride

Sign In for Pricing
View Details
Lentiviral mouse Gsta3 shRNA (UAS) - Lentiviral mouseGsta3 shRNA (UAS, GFP) (25)
GTR15303239 1 Vial

Lentiviral mouse Gsta3 shRNA (UAS) - Lentiviral mouseGsta3 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Rabbit Anti-Human RAVER1 pAb
PA6760-01 50 μL

Rabbit Anti-Human RAVER1 pAb

Sign In for Pricing
View Details
Rabbit Anti-Human RAVER1 pAb
PA6760-02 100 μL

Rabbit Anti-Human RAVER1 pAb

Sign In for Pricing
View Details
IFN-gamma Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-41061R-BF488 100 µL

IFN-gamma Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
SNTA1 Peptide - N-terminal region (AAP65971)
AAP65971-100UG 100 µg

SNTA1 Peptide - N-terminal region (AAP65971)

Sign In for Pricing
View Details