Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IFN gamma protein

This Human IFN gamma protein spans the amino acid sequence from region 24-166aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Interferon Gamma; IFN-Gamma; Immune Interferon; IFNG

UniProt

P01579

Expression Region

24-166aa

Tag

Tag-Free

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Infectious Disease & Virology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined by a cytotoxicity assay using HT-29 cells is 17 pg/ml.

Form

Lyophilized powder

Molecular Weight

16.88 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

Lyophilized from a 0.2 μm filtered 20mM Tris-HCl, 250mM NaCl, pH 8.5.

AA Sequence

QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Peripherin Antibody
8C0301-AAT 50 µg

Peripherin Antibody

Sign In for Pricing
View Details
Rnaseh1 Mouse Gene Knockout Kit (CRISPR)
KN514874 1 Kit

Rnaseh1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human FBXO39 activation kit by CRISPRa
GA116053 1 Kit

Human FBXO39 activation kit by CRISPRa

Sign In for Pricing
View Details
(RS)-20,22-Dihydrodigoxigenin
TRC-D452290-25MG 25 mg

(RS)-20,22-Dihydrodigoxigenin

Sign In for Pricing
View Details
CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (rKi-1/779), CF594 conjugate, 0.1mg/mL
BNC941828-100 1x 100 µL

CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (rKi-1/779), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ADAR1 (ADAR) (NM_001025107) Human Over-expression Lysate
LY425483 100 µg

ADAR1 (ADAR) (NM_001025107) Human Over-expression Lysate

Sign In for Pricing
View Details