Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IFNA2 protein

This Human IFNA2 protein spans the amino acid sequence from region 24-188aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Interferon Alpha-2; IFN-Alpha-2; Interferon Alpha-A; LeIF A; IFNA2

UniProt

P01563

Expression Region

24-188aa

Tag

Tag-Free

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Infectious Disease & Virology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined in antiviral assay using A549 human lung cancer cells infected with vesicular stomatitisvirus (VSV) is 5 ng/mL.

Form

Lyophilized powder

Molecular Weight

19.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.2

AA Sequence

CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Cystathionine beta-synthase CBS Antibody Picoband® (iFluor647 Conjugate)
RP1041-iFluor647 100 µg

Anti-Cystathionine beta-synthase CBS Antibody Picoband® (iFluor647 Conjugate)

Sign In for Pricing
View Details
Xpress™ Human PRAMEF15 Over-expressing Stable Cell Line
ABC-X2450 1 Vial

Xpress™ Human PRAMEF15 Over-expressing Stable Cell Line

Sign In for Pricing
View Details
Concizumab Antibody
orb1944800-01 1 mg

Concizumab Antibody

Sign In for Pricing
View Details
Concizumab Antibody
orb1944800-02 5 mg

Concizumab Antibody

Sign In for Pricing
View Details
Concizumab Antibody
orb1944800-03 10 mg

Concizumab Antibody

Sign In for Pricing
View Details
Concizumab Antibody
orb1944800-04 25 mg

Concizumab Antibody

Sign In for Pricing
View Details