Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Fgf2 protein

This Rat Fgf2 protein spans the amino acid sequence from region 11-154aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fibroblast Growth Factor 2; FGF-2; Basic Fibroblast Growth Factor; bFGF; Heparin-Binding Growth Factor 2; HBGF-2; FGF2; FGFB

UniProt

P13109

Expression Region

11-154aa

Tag

Tag-Free

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Cardiovascular Research

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells is 0.3-1.8 ng/ml.

Form

Lyophilized powder

Molecular Weight

16.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4

AA Sequence

ALPEDGGGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CD73 Antibody, Mouse Monoclonal
MBS8104311-01 0.1 mL

Anti-CD73 Antibody, Mouse Monoclonal

Sign In for Pricing
View Details
Anti-CD73 Antibody, Mouse Monoclonal
MBS8104311-02 5x 0.1 mL

Anti-CD73 Antibody, Mouse Monoclonal

Sign In for Pricing
View Details
2-Bromo-2'-chlorophenyl acetic acid methyl ester
266465-01 500 mg

2-Bromo-2'-chlorophenyl acetic acid methyl ester

Sign In for Pricing
View Details
2-Bromo-2'-chlorophenyl acetic acid methyl ester
266465-02 1 g

2-Bromo-2'-chlorophenyl acetic acid methyl ester

Sign In for Pricing
View Details
2-Bromo-2'-chlorophenyl acetic acid methyl ester
266465-03 2 g

2-Bromo-2'-chlorophenyl acetic acid methyl ester

Sign In for Pricing
View Details
2-Bromo-2'-chlorophenyl acetic acid methyl ester
266465-04 5 g

2-Bromo-2'-chlorophenyl acetic acid methyl ester

Sign In for Pricing
View Details