Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Fgf9 protein

This Mouse Fgf9 protein spans the amino acid sequence from region 1-208aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fibroblast growth factor 9; FGF-9; Glia-activating factor; GAF; heparin-binding growth factor-9; HBGF-9; Fgf9; Fgf-9

UniProt

P54130

Expression Region

1-208aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells is 4.14 ng/ml.

Form

Liquid

Molecular Weight

24.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

0.2 μm filtered 20 mM Tris-HCl, 150 mM NaCl, 5% Trehalose, 1 mM EDTA, 20% Glycerol, 1 mM DTT, pH 8.5

AA Sequence

MAPLGEVGSYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBP2 (NM_004164) Human Mass Spec Standard
PH317970 10 µg

RBP2 (NM_004164) Human Mass Spec Standard

Sign In for Pricing
View Details
DEDD2 (Death Effector Domain-containing DNA Binding 2) (APC) discontinued
D1890-03-APC 100 µL

DEDD2 (Death Effector Domain-containing DNA Binding 2) (APC) discontinued

Sign In for Pricing
View Details
RBPMS Peptide (AAP40268)
AAP40268-100UG 100 µg

RBPMS Peptide (AAP40268)

Sign In for Pricing
View Details
Mouse Monoclonal CXCR3 Antibody (868013) [PE/Cy7]
FAB8109PECY7 0.1 mL

Mouse Monoclonal CXCR3 Antibody (868013) [PE/Cy7]

Sign In for Pricing
View Details
APRIL Antibody
24136 100 µL

APRIL Antibody

Sign In for Pricing
View Details
Pald1 (NM_013753) Mouse Recombinant Protein
TP514282 20 µg

Pald1 (NM_013753) Mouse Recombinant Protein

Sign In for Pricing
View Details