Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Egf protein

This Mouse Egf protein spans the amino acid sequence from region 977-1029aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pro-epidermal growth factor; Epidermal growth factor; EGF

UniProt

P01132

Expression Region

977-1029aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cancer Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined by its ability to inhibits the proliferation of human epithelial A431 cells is 2-20 ng/ml.

Form

Lyophilized powder

Molecular Weight

7.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4

AA Sequence

NSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monoclonal Antibody to Renin (REN)
MBS2138794-01 0.1 mL

Monoclonal Antibody to Renin (REN)

Sign In for Pricing
View Details
Monoclonal Antibody to Renin (REN)
MBS2138794-02 0.2 mL

Monoclonal Antibody to Renin (REN)

Sign In for Pricing
View Details
Monoclonal Antibody to Renin (REN)
MBS2138794-03 0.5 mL

Monoclonal Antibody to Renin (REN)

Sign In for Pricing
View Details
Monoclonal Antibody to Renin (REN)
MBS2138794-04 1 mL

Monoclonal Antibody to Renin (REN)

Sign In for Pricing
View Details
Monoclonal Antibody to Renin (REN)
MBS2138794-05 5 mL

Monoclonal Antibody to Renin (REN)

Sign In for Pricing
View Details
Monoclonal Antibody to Renin (REN)
MBS2138794-06 5x 5 mL

Monoclonal Antibody to Renin (REN)

Sign In for Pricing
View Details