Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Kitlg protein

This Mouse Kitlg protein spans the amino acid sequence from region 26-189aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Kit ligand; Hematopoietic growth factor KL; Mast cell growth factor; MGF; Steel factor; Stem cell factor; SCF

UniProt

P20826

Expression Region

26-189aa

Tag

Tag-Free

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined by the dose-dependent stimulation of TF-1 cells is 4-12 ng/ml.

Form

Lyophilized powder

Molecular Weight

18.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4

AA Sequence

KEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Factor Protein, Human, Recombinant (hFc & Avi), Biotinylated
TMPY-06957-01 5 µg

Tissue Factor Protein, Human, Recombinant (hFc & Avi), Biotinylated

Sign In for Pricing
View Details
Tissue Factor Protein, Human, Recombinant (hFc & Avi), Biotinylated
TMPY-06957-02 10 µg

Tissue Factor Protein, Human, Recombinant (hFc & Avi), Biotinylated

Sign In for Pricing
View Details
Tissue Factor Protein, Human, Recombinant (hFc & Avi), Biotinylated
TMPY-06957-03 20 µg

Tissue Factor Protein, Human, Recombinant (hFc & Avi), Biotinylated

Sign In for Pricing
View Details
Tissue Factor Protein, Human, Recombinant (hFc & Avi), Biotinylated
TMPY-06957-04 50 µg

Tissue Factor Protein, Human, Recombinant (hFc & Avi), Biotinylated

Sign In for Pricing
View Details
Tissue Factor Protein, Human, Recombinant (hFc & Avi), Biotinylated
TMPY-06957-05 100 µg

Tissue Factor Protein, Human, Recombinant (hFc & Avi), Biotinylated

Sign In for Pricing
View Details
LMO2  polyclonal antibody
BZ16826 50ul

LMO2 polyclonal antibody

Sign In for Pricing
View Details