Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Fgf2 protein

This Mouse Fgf2 protein spans the amino acid sequence from region 1-154aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fibroblast Growth Factor 2; FGF-2; Basic Fibroblast Growth Factor; bFGF; Heparin-Binding Growth Factor 2; HBGF-2; Fgf2; Fgf-2

UniProt

P15655

Expression Region

1-154aa

Tag

Tag-Free

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cardiovascular Research

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined in a cell proliferation assay using BALB/c 3T3 cells is 0.3-1.8 ng/ml.

Form

Lyophilized powder

Molecular Weight

17.15 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 400mM NaCl, 0.02% Tween 80, 4.0% Sucrose, 4.0% Manntiol, pH 7.0

AA Sequence

MAASGITSLPALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CPO siRNA
abx912692-01 15 nmol

Human CPO siRNA

Sign In for Pricing
View Details
Human CPO siRNA
abx912692-02 30 nmol

Human CPO siRNA

Sign In for Pricing
View Details
ASMEPM-37X230MM-LOW PRESSURE STEAM Pipe Markers for Steam
312925 3 Card (3 Marker (s) x 1 Pack)

ASMEPM-37X230MM-LOW PRESSURE STEAM Pipe Markers for Steam

Sign In for Pricing
View Details
Topiroxostat Impurity 24
RM-T161850-01 10 mg

Topiroxostat Impurity 24

Sign In for Pricing
View Details
Topiroxostat Impurity 24
RM-T161850-02 25 mg

Topiroxostat Impurity 24

Sign In for Pricing
View Details
Topiroxostat Impurity 24
RM-T161850-03 50 mg

Topiroxostat Impurity 24

Sign In for Pricing
View Details