Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FGF8 protein

This Human FGF8 protein spans the amino acid sequence from region 23-215aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fibroblast growth factor 8; Androgen-induced growth factor; Heparin-binding growth factor 8; AIGF; HBGF-8; FGF-8B

UniProt

P37237, P55075

Expression Region

23-215aa

Tag

Tag-Free

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined in a cell proliferation assay using BALB/c 3T3 cells is 21.87 ng/ml.

Form

Lyophilized powder

Molecular Weight

22.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial of Isoform 3

Preservative

Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4

AA Sequence

QVTVQSSPNFTQHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NTE Polyclonal Antibody
MBS8524181-01 0.1 mg

NTE Polyclonal Antibody

Sign In for Pricing
View Details
NTE Polyclonal Antibody
MBS8524181-02 0.1 mL (AF635)

NTE Polyclonal Antibody

Sign In for Pricing
View Details
NTE Polyclonal Antibody
MBS8524181-03 0.1 mL (AF610)

NTE Polyclonal Antibody

Sign In for Pricing
View Details
NTE Polyclonal Antibody
MBS8524181-04 0.1 mL (AF405S)

NTE Polyclonal Antibody

Sign In for Pricing
View Details
NTE Polyclonal Antibody
MBS8524181-05 0.1 mL (AF405L)

NTE Polyclonal Antibody

Sign In for Pricing
View Details
NTE Polyclonal Antibody
MBS8524181-06 0.1 mL (AF546)

NTE Polyclonal Antibody

Sign In for Pricing
View Details