Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human THPO protein

This Human THPO protein spans the amino acid sequence from region 22-353aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Thrombopoietin; C-mpl ligand; Megakaryocyte colony-stimulating factor; Megakaryocyte growth and development factor; Myeloproliferative leukemia virus oncogene ligand; THPO

UniProt

P40225

Expression Region

22-353aa

Tag

N-terminal 6xHis-tagged and C-terminal 6xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined in a cell proliferation assay using MO7E human megakaryocytic leukemic cells is 0.55 ng/ml.

Form

Lyophilized powder

Molecular Weight

37.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 150 mM NaCl, pH 8.0

AA Sequence

SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Chloro-N, N-dimethyl-5-nitrobenzene-1-sulfonamide
KAA37290-01 0.5 g

2-Chloro-N, N-dimethyl-5-nitrobenzene-1-sulfonamide

Sign In for Pricing
View Details
2-Chloro-N, N-dimethyl-5-nitrobenzene-1-sulfonamide
KAA37290-02 5 g

2-Chloro-N, N-dimethyl-5-nitrobenzene-1-sulfonamide

Sign In for Pricing
View Details
BURP14 Antibody
orb838544 2 mg

BURP14 Antibody

Sign In for Pricing
View Details
Human RFX2 Knockout HEK293T cell line
GTR15405249 1 Vial

Human RFX2 Knockout HEK293T cell line

Sign In for Pricing
View Details
TMEM263 Human Pre-designed siRNA Set A
HY-RS14715 1 Set

TMEM263 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
Anti-Vimentin (Phospho-S56) Antibody
CQA8155-01 30 µL

Anti-Vimentin (Phospho-S56) Antibody

Sign In for Pricing
View Details