Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human NGF protein

This Human NGF protein spans the amino acid sequence from region 122-239aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Beta-Nerve Growth Factor; Beta-NGF; NGF; NGFB

UniProt

P01138

Expression Region

122-239aa

Tag

Tag-Free

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined in a cell proliferation assay using TF‐1 human erythroleukemic cells is 0.04-0.4 ng/ml.

Form

Lyophilized powder

Molecular Weight

13.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

Lyophilized from a 0.2 μm filtered 20 mM PB, 250 mM NaCl, pH 7.0

AA Sequence

SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Plasmodium Falciparum Aspartic acid-rich Protein (aa 23-253)
VAng-Wyb6366-1mgBaculovirus 1 mg (Baculovirus)

Recombinant Plasmodium Falciparum Aspartic acid-rich Protein (aa 23-253)

Sign In for Pricing
View Details
LINC00328 Protein Vector (Human) (pPB-N-His)
PV091375 500 ng

LINC00328 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
CYTSB discontinued
508600 100 µg

CYTSB discontinued

Sign In for Pricing
View Details
Fc Fragment of IgG Low Affinity IIIa Receptor (FCGR3A) Antibody
abx405523-01 100 µL

Fc Fragment of IgG Low Affinity IIIa Receptor (FCGR3A) Antibody

Sign In for Pricing
View Details
Fc Fragment of IgG Low Affinity IIIa Receptor (FCGR3A) Antibody
abx405523-02 200 µL

Fc Fragment of IgG Low Affinity IIIa Receptor (FCGR3A) Antibody

Sign In for Pricing
View Details
Fc Fragment of IgG Low Affinity IIIa Receptor (FCGR3A) Antibody
abx405523-03 1 mL

Fc Fragment of IgG Low Affinity IIIa Receptor (FCGR3A) Antibody

Sign In for Pricing
View Details