Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human KITLG protein

This Human KITLG protein spans the amino acid sequence from region 26-214aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Kit Ligand; Mast Cell Growth Factor; MGF; Stem Cell Factor; SCF; c-Kit ligand; KITLG; MGF; SCF

UniProt

P21583

Expression Region

26-214aa

Tag

C-terminal 6xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined in a cell proliferation assay using TF‐1 human erythroleukemic cells is 2-10 ng/ml.

Form

Lyophilized powder

Molecular Weight

22 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4

AA Sequence

EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKAKNPPGDSSLH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Mafa shRNA (UAS) - Lentiviral mouse Mafa shRNA (UAS, RFP) (100)
GTR15231744 1 Vial

Lentiviral mouse Mafa shRNA (UAS) - Lentiviral mouse Mafa shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Anti-DNA Antibody (BKD34)
ARO-A14439-01 50 µg

Anti-DNA Antibody (BKD34)

Sign In for Pricing
View Details
Anti-DNA Antibody (BKD34)
ARO-A14439-02 100 µg

Anti-DNA Antibody (BKD34)

Sign In for Pricing
View Details
Anti-DNA Antibody (BKD34)
ARO-A14439-03 1 mg

Anti-DNA Antibody (BKD34)

Sign In for Pricing
View Details
IKKB, Phosphorylated (Tyr199) (Inhibitor Of Nuclear Factor kappa B Kinase beta Subunit, I-kappa-B-kinase beta, IkBKB, IKK-beta, IKK-B, I-kappa-B Kinase 2, IKK2, Nuclear Factor NF-kappa-B Inhibitor Kinase beta, NFKBIKB, IKBKB) (Biotin)
MBS6481430-01 0.2 mL

IKKB, Phosphorylated (Tyr199) (Inhibitor Of Nuclear Factor kappa B Kinase beta Subunit, I-kappa-B-kinase beta, IkBKB, IKK-beta, IKK-B, I-kappa-B Kinase 2, IKK2, Nuclear Factor NF-kappa-B Inhibitor Kinase beta, NFKBIKB, IKBKB) (Biotin)

Sign In for Pricing
View Details
IKKB, Phosphorylated (Tyr199) (Inhibitor Of Nuclear Factor kappa B Kinase beta Subunit, I-kappa-B-kinase beta, IkBKB, IKK-beta, IKK-B, I-kappa-B Kinase 2, IKK2, Nuclear Factor NF-kappa-B Inhibitor Kinase beta, NFKBIKB, IKBKB) (Biotin)
MBS6481430-02 5x 0.2 mL

IKKB, Phosphorylated (Tyr199) (Inhibitor Of Nuclear Factor kappa B Kinase beta Subunit, I-kappa-B-kinase beta, IkBKB, IKK-beta, IKK-B, I-kappa-B Kinase 2, IKK2, Nuclear Factor NF-kappa-B Inhibitor Kinase beta, NFKBIKB, IKBKB) (Biotin)

Sign In for Pricing
View Details