Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human KITLG protein

This Human KITLG protein spans the amino acid sequence from region 26-214aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Kit Ligand; Mast Cell Growth Factor; MGF; Stem Cell Factor; SCF; c-Kit ligand; KITLG; MGF; SCF

UniProt

P21583

Expression Region

26-214aa

Tag

C-terminal 6xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined in a cell proliferation assay using TF‐1 human erythroleukemic cells is 2-10 ng/ml.

Form

Lyophilized powder

Molecular Weight

22 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4

AA Sequence

EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKAKNPPGDSSLH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BI-4924
BA8242-10 10 mg

BI-4924

Sign In for Pricing
View Details
NID1 siRNA (Mouse)
CRM2773-01 15 nmol

NID1 siRNA (Mouse)

Sign In for Pricing
View Details
NID1 siRNA (Mouse)
CRM2773-02 30 nmol

NID1 siRNA (Mouse)

Sign In for Pricing
View Details
MED4 (ARC36, DRIP36, VDRIP, Mediator of RNA Polymerase II Transcription Subunit 4, Activator-recruited Cofactor 36kD Component, Mediator Complex Subunit 4, TRAP/SMCC/PC2 Subunit p36 Subunit, Vitamin D3 Receptor-interacting Protein Complex 36kD Component) (MaxLight 550)
129546-ML550 100 µL

MED4 (ARC36, DRIP36, VDRIP, Mediator of RNA Polymerase II Transcription Subunit 4, Activator-recruited Cofactor 36kD Component, Mediator Complex Subunit 4, TRAP/SMCC/PC2 Subunit p36 Subunit, Vitamin D3 Receptor-interacting Protein Complex 36kD Component) (MaxLight 550)

Sign In for Pricing
View Details
ZNF317 Recombinant Protein (Human)
RP035734 100 µg

ZNF317 Recombinant Protein (Human)

Sign In for Pricing
View Details
Paper filter disc diam.240mm medium qualitative 01 10,0um retention GVS 100 pc FOLDED FORMAT
FP240DME01QALC0F 100 Pieces/Case:100 Pieces/ PACKS:1 PACKS/CASE

Paper filter disc diam.240mm medium qualitative 01 10,0um retention GVS 100 pc FOLDED FORMAT

Sign In for Pricing
View Details