Human KITLG protein
This Human KITLG protein spans the amino acid sequence from region 26-214aa. Purity: Greater than 95% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Kit Ligand; Mast Cell Growth Factor; MGF; Stem Cell Factor; SCF; c-Kit ligand; KITLG; MGF; SCF
UniProt
P21583
Expression Region
26-214aa
Tag
C-terminal 6xHis-tagged
Source
Mammalian cell
Origin
Homo sapiens (Human)
Field of Research
Immunology & Inflammation
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Purity
Greater than 95% as determined by SDS-PAGE.
Bioactivity
The ED50 as determined in a cell proliferation assay using TF‐1 human erythroleukemic cells is 2-10 ng/ml.
Form
Lyophilized powder
Molecular Weight
22 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Partial
Preservative
Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4
AA Sequence
EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKAKNPPGDSSLH
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
125494-Biotin 100 µL
CXADR (Coxsackievirus And Adenovirus Receptor, Coxsackievirus B-adenovirus Receptor, HCVADR, CVB3-binding Protein, CAR) (Biotin)
Sign In for Pricing
View Details 
250606-APC 100 µL
PSMG1 (Proteasome (Prosome, Macropain) Assembly Chaperone 1, C21LRP, DSCR2, LRPC21, PAC1) (APC)
Sign In for Pricing
View Details 
M4701-95F 500 µg
Mucin 16 (MUC16, MUC-16, CA125, CA-125, CA125 Ovarian Cancer Antigen, Cancer Antigen 125, FLJ14303, Mucin 16 Cell Surface Associated, Ovarian Cancer Antigen, Ovarian Cancer-related Tumor Marker CA125, Ovarian Carcinoma Antigen CA125)
Sign In for Pricing
View Details GTR15112796 1 Vial
Lentiviral human LAS1L shRNA (UAS) - Lentiviral human LAS1L shRNA (UAS, GFP) (25)
Sign In for Pricing
View Details