Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TGF beta 1 protein

This Human TGF beta 1 protein spans the amino acid sequence from region 279-390aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Transforming Growth Factor Beta-1; TGF-Beta-1; Latency-Associated Peptide; LAP; TGFB1; TGFB

UniProt

P01137

Expression Region

279-390aa

Tag

Tag-Free

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined by its ability to inhibit the IL-4-dependent proliferation of TF‐1 human erythroleukemic cells is 4-40 pg/ml.

Form

Lyophilized powder

Molecular Weight

12.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

Lyophilized from a 0.2 μm filtered 50mM Glycine-HCl, 150mMNacl, pH 2.5

AA Sequence

ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TentaGel® HL CHO
HL12906.25G 25 g

TentaGel® HL CHO

Sign In for Pricing
View Details
ITGB6 Antibody
KC-3539-01 50 μL

ITGB6 Antibody

Sign In for Pricing
View Details
ITGB6 Antibody
KC-3539-02 100 µL

ITGB6 Antibody

Sign In for Pricing
View Details
ITGB6 Antibody
KC-3539-03 1 mL

ITGB6 Antibody

Sign In for Pricing
View Details
2-amino-4-cyanobenzoic acid
TRC-A605403-50MG 50 mg

2-amino-4-cyanobenzoic acid

Sign In for Pricing
View Details
H2BC5 Rabbit Polyclonal Antibody
TA377052 100 µL

H2BC5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details