Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FGF17 protein

This Human FGF17 protein spans the amino acid sequence from region 23-216aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fibroblast Growth Factor 17; FGF-17; FGF17

UniProt

O60258

Expression Region

23-216aa

Tag

C-terminal 6xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells is 2.1 ug/ml.

Form

Lyophilized powder

Molecular Weight

22.64 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4

AA Sequence

TQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAEKQKQFEFVGSAPTRRTKRTRRPQPLT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Alpha-2-Macroglobulin (A2M) Antibody
abx101949-01 100 µL

Alpha-2-Macroglobulin (A2M) Antibody

Sign In for Pricing
View Details
Alpha-2-Macroglobulin (A2M) Antibody
abx101949-02 200 µL

Alpha-2-Macroglobulin (A2M) Antibody

Sign In for Pricing
View Details
Alpha-2-Macroglobulin (A2M) Antibody
abx101949-03 1 mL

Alpha-2-Macroglobulin (A2M) Antibody

Sign In for Pricing
View Details
Epsilon Tubulin Mouse Monoclonal Antibody (3C1)
E044189 100 µg -100 µL

Epsilon Tubulin Mouse Monoclonal Antibody (3C1)

Sign In for Pricing
View Details
IFluor® 670 Anti-human CD22 Antibody *HIB22*
102200H1-AAT 500 Tests

IFluor® 670 Anti-human CD22 Antibody *HIB22*

Sign In for Pricing
View Details
Rabbit Polyclonal Genethonin 1 Antibody
NBP2-16640 0.1 mL

Rabbit Polyclonal Genethonin 1 Antibody

Sign In for Pricing
View Details