Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FGF2 protein

This Human FGF2 protein spans the amino acid sequence from region 143-288aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fibroblast growth factor 2; FGF-2; Basic fibroblast growth factor; bFGF; Heparin-binding growth factor 2; HBGF-2

UniProt

P09038

Expression Region

143-288aa

Tag

Tag-Free

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined in a cell proliferation assay using BALB/c 3T3 cells is 0.3-2.0 ng/ml.

Form

Lyophilized powder

Molecular Weight

16.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

Lyophilized from a 0.2 μm filtered 20mM Tris-Hcl, 250mM NaCl, pH 7.5.

AA Sequence

PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti Human NRG1 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (Western Blot, IHC, ELISA) 200UL
IRBAMLNRG1AP91200UL 200 µL

Rabbit Anti Human NRG1 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (Western Blot, IHC, ELISA) 200UL

Sign In for Pricing
View Details
Dengue Virus Serotype 2 Envelope Protein, Strain Thailand/16681/84, Recombinant, Mammalian, aa279-679, His-Tag discontinued
397630 100 µg

Dengue Virus Serotype 2 Envelope Protein, Strain Thailand/16681/84, Recombinant, Mammalian, aa279-679, His-Tag discontinued

Sign In for Pricing
View Details
Granulocyte Macrophage Colony Stimulating Factor, Recombinant, Human, aa18-144, His-Tag (GM-CSF) discontinued
299409-01 2 µg

Granulocyte Macrophage Colony Stimulating Factor, Recombinant, Human, aa18-144, His-Tag (GM-CSF) discontinued

Sign In for Pricing
View Details
Granulocyte Macrophage Colony Stimulating Factor, Recombinant, Human, aa18-144, His-Tag (GM-CSF) discontinued
299409-02 10 µg

Granulocyte Macrophage Colony Stimulating Factor, Recombinant, Human, aa18-144, His-Tag (GM-CSF) discontinued

Sign In for Pricing
View Details
Chicken NUP155 (Nucleoporin 155kDa) ELISA Kit
MBS2509856-01 24 Tests

Chicken NUP155 (Nucleoporin 155kDa) ELISA Kit

Sign In for Pricing
View Details
Chicken NUP155 (Nucleoporin 155kDa) ELISA Kit
MBS2509856-02 48 Tests

Chicken NUP155 (Nucleoporin 155kDa) ELISA Kit

Sign In for Pricing
View Details