Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FGF2 protein

This Human FGF2 protein spans the amino acid sequence from region 143-288aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fibroblast growth factor 2; FGF-2; Basic fibroblast growth factor; bFGF; Heparin-binding growth factor 2; HBGF-2

UniProt

P09038

Expression Region

143-288aa

Tag

Tag-Free

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined in a cell proliferation assay using BALB/c 3T3 cells is 0.3-2.0 ng/ml.

Form

Lyophilized powder

Molecular Weight

16.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

Lyophilized from a 0.2 μm filtered 20mM Tris-Hcl, 250mM NaCl, pH 7.5.

AA Sequence

PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rbp2 (NM_009034) Mouse Tagged ORF Clone Lentiviral Particle
MR217546L4V 200 µL

Rbp2 (NM_009034) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Hydroxymethylglutaryl-CoA synthase, cytoplasmic (Hmgcs1) (Biotin)
319808-01 50 µg

Hydroxymethylglutaryl-CoA synthase, cytoplasmic (Hmgcs1) (Biotin)

Sign In for Pricing
View Details
Hydroxymethylglutaryl-CoA synthase, cytoplasmic (Hmgcs1) (Biotin)
319808-02 100 µg

Hydroxymethylglutaryl-CoA synthase, cytoplasmic (Hmgcs1) (Biotin)

Sign In for Pricing
View Details
PCGF5 Adenovirus (Rat)
36193056 1.0 mL

PCGF5 Adenovirus (Rat)

Sign In for Pricing
View Details
Cd300e 3'UTR Lenti-reporter-Luc Vector
15523086 1.0 µg

Cd300e 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
FAM62A (ESYT1) (NM_015292) Human Tagged ORF Clone Lentiviral Particle
RC201380L4V 200 µL

FAM62A (ESYT1) (NM_015292) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details