Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FGF9 protein

This Human FGF9 protein spans the amino acid sequence from region 1-208aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fibroblast Growth Factor 9; FGF-9; Glia-Activating Factor; GAF; Heparin-Binding Growth Factor 9; HBGF-9; FGF9

UniProt

P31371

Expression Region

1-208aa

Tag

Tag-Free

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells is 1-5 ng/ml.

Form

Lyophilized powder

Molecular Weight

23.44 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, 5% Trehalos, pH 7.4

AA Sequence

MAPLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GLI1 Mouse Monoclonal Antibody [Clone ID: OTI2C7]
TA803919S 30 µL

GLI1 Mouse Monoclonal Antibody [Clone ID: OTI2C7]

Sign In for Pricing
View Details
Mouse Human Enolase Antibody
orb109169 200 µg

Mouse Human Enolase Antibody

Sign In for Pricing
View Details
Recombinant Campylobacter Jejuni pdxA Protein (aa 1-364) (strain 81-176)
VAng-Ly2256-500gEcoli 500 µg (E. coli)

Recombinant Campylobacter Jejuni pdxA Protein (aa 1-364) (strain 81-176)

Sign In for Pricing
View Details
Neurotensin Receptor 1
MBS8578062-01 0.1 mL

Neurotensin Receptor 1

Sign In for Pricing
View Details
Neurotensin Receptor 1
MBS8578062-02 0.1 mL (AF405L)

Neurotensin Receptor 1

Sign In for Pricing
View Details
Neurotensin Receptor 1
MBS8578062-03 0.1 mL (AF405S)

Neurotensin Receptor 1

Sign In for Pricing
View Details