Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FGF9 protein

This Human FGF9 protein spans the amino acid sequence from region 1-208aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fibroblast Growth Factor 9; FGF-9; Glia-Activating Factor; GAF; Heparin-Binding Growth Factor 9; HBGF-9; FGF9

UniProt

P31371

Expression Region

1-208aa

Tag

Tag-Free

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells is 1-5 ng/ml.

Form

Lyophilized powder

Molecular Weight

23.44 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, 5% Trehalos, pH 7.4

AA Sequence

MAPLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse NKG2A/NKG2B Isoform 2 Fc Protein CF
9330-NK-050 50 µg

Recombinant Mouse NKG2A/NKG2B Isoform 2 Fc Protein CF

Sign In for Pricing
View Details
Recombinant Human CFAP100 Protein
E30P64195C 50 µg

Recombinant Human CFAP100 Protein

Sign In for Pricing
View Details
GSK-3 Beta Monoclonal Antibody, FITC Conjugated
bsm-63070R-FITC 100 µL

GSK-3 Beta Monoclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
C23 Lentiviral Activation Particles (h)
sc-400191-LAC 200 µL

C23 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
MED8 Rabbit Polyclonal Antibody
orb3069334-01 30 µL

MED8 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MED8 Rabbit Polyclonal Antibody
orb3069334-02 50 µL

MED8 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details