Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human BDNF protein

This Human BDNF protein spans the amino acid sequence from region 129-247aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Brain-Derived Neurotrophic Factor; BDNF; Abrineurin

UniProt

P23560

Expression Region

129-247aa

Tag

Tag-Free

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human TrkB (C-6His) at 5 μg/mL can bind Human BDNF, Biotinylated by NHS-biotin prior to testing, the EC50 of Human BDNF is ≤20 ng/mL.

Form

Lyophilized powder

Molecular Weight

13 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

Lyophilized from a 0.2 μm filtered 20 mM PB, 250 mM NaCl, pH 7.2

AA Sequence

HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Integrin, beta1, active (ITGB1, Integrin, beta 1 (Fibronectin Receptor, beta Polypeptide, Antigen CD29 includes MDF2, MSK12), CD29, Fibronectin Receptor Subunit beta, FNRB, GPIIA, MDF2, MSK12, VLA-4 Subunit beta, VLAB, VLA-BETA) (MaxLight 750)
MBS6247047-01 0.1 mL

Integrin, beta1, active (ITGB1, Integrin, beta 1 (Fibronectin Receptor, beta Polypeptide, Antigen CD29 includes MDF2, MSK12), CD29, Fibronectin Receptor Subunit beta, FNRB, GPIIA, MDF2, MSK12, VLA-4 Subunit beta, VLAB, VLA-BETA) (MaxLight 750)

Sign In for Pricing
View Details
Integrin, beta1, active (ITGB1, Integrin, beta 1 (Fibronectin Receptor, beta Polypeptide, Antigen CD29 includes MDF2, MSK12), CD29, Fibronectin Receptor Subunit beta, FNRB, GPIIA, MDF2, MSK12, VLA-4 Subunit beta, VLAB, VLA-BETA) (MaxLight 750)
MBS6247047-02 5x 0.1 mL

Integrin, beta1, active (ITGB1, Integrin, beta 1 (Fibronectin Receptor, beta Polypeptide, Antigen CD29 includes MDF2, MSK12), CD29, Fibronectin Receptor Subunit beta, FNRB, GPIIA, MDF2, MSK12, VLA-4 Subunit beta, VLAB, VLA-BETA) (MaxLight 750)

Sign In for Pricing
View Details
Epor Rat Pre-designed siRNA Set A
HY-RS24835 1 Set

Epor Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details
Recombinant Sodalis glossinidius DNA-directed RNA polymerase subunit alpha (rpoA)
MBS1448883-01 0.02 mg (E-Coli)

Recombinant Sodalis glossinidius DNA-directed RNA polymerase subunit alpha (rpoA)

Sign In for Pricing
View Details
Recombinant Sodalis glossinidius DNA-directed RNA polymerase subunit alpha (rpoA)
MBS1448883-02 0.02 mg (Yeast)

Recombinant Sodalis glossinidius DNA-directed RNA polymerase subunit alpha (rpoA)

Sign In for Pricing
View Details
Recombinant Sodalis glossinidius DNA-directed RNA polymerase subunit alpha (rpoA)
MBS1448883-03 0.1 mg (E-Coli)

Recombinant Sodalis glossinidius DNA-directed RNA polymerase subunit alpha (rpoA)

Sign In for Pricing
View Details