Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FGF2 protein

This Human FGF2 protein spans the amino acid sequence from region 132-288aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fibroblast Growth Factor 2; FGF-2; Basic Fibroblast Growth Factor; bFGF; Heparin-Binding Growth Factor 2; HBGF-2; FGF2; FGFB

UniProt

P09038

Expression Region

132-288aa

Tag

Tag-Free

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined in a cell proliferation assay using BALB/c 3T3 cells is 1.11 ng/ml.

Form

Lyophilized powder

Molecular Weight

17.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 150 mM NaCl, pH 7.5

AA Sequence

GTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL22RA2 Protein (C-His, Cynomolgus)
P525859 100 µg

IL22RA2 Protein (C-His, Cynomolgus)

Sign In for Pricing
View Details
HEV IgM Rapid Test
R0095C 30 Cassettes

HEV IgM Rapid Test

Sign In for Pricing
View Details
LAMA2 Antibody / Laminin alpha 2
R31280 100 µg

LAMA2 Antibody / Laminin alpha 2

Sign In for Pricing
View Details
TNFRSF13B Protein (C-His, Human)
P529066 100 µg

TNFRSF13B Protein (C-His, Human)

Sign In for Pricing
View Details
ASPSCR1 (ASPL, RCC17, TUG, UBXD9, UBXN9, Tether Containing UBX Domain for GLUT4, Alveolar Soft Part Sarcoma Chromosomal Region Candidate Gene 1 Protein, Alveolar Soft Part Sarcoma Locus, Renal Papillary Cell Carcinoma Protein 17, UBX Domain-containing Protein 9) (PE)
123644-PE 100 µL

ASPSCR1 (ASPL, RCC17, TUG, UBXD9, UBXN9, Tether Containing UBX Domain for GLUT4, Alveolar Soft Part Sarcoma Chromosomal Region Candidate Gene 1 Protein, Alveolar Soft Part Sarcoma Locus, Renal Papillary Cell Carcinoma Protein 17, UBX Domain-containing Protein 9) (PE)

Sign In for Pricing
View Details
LRP4 Polyclonal Antibody
MBS8530167-01 0.1 mg

LRP4 Polyclonal Antibody

Sign In for Pricing
View Details