Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FGF2 protein

This Human FGF2 protein spans the amino acid sequence from region 132-288aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fibroblast Growth Factor 2; FGF-2; Basic Fibroblast Growth Factor; bFGF; Heparin-Binding Growth Factor 2; HBGF-2; FGF2; FGFB

UniProt

P09038

Expression Region

132-288aa

Tag

Tag-Free

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined in a cell proliferation assay using BALB/c 3T3 cells is 1.11 ng/ml.

Form

Lyophilized powder

Molecular Weight

17.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 150 mM NaCl, pH 7.5

AA Sequence

GTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRK5 Antibody
orb1533886 50 µg

GRK5 Antibody

Sign In for Pricing
View Details
Collagen Type XI Alpha 2 antibody
70R-6183 100 µL

Collagen Type XI Alpha 2 antibody

Sign In for Pricing
View Details
HIV-1 Gag p55, active as HIV-1 protease substrate, SDS-PAGE, WB, Dot Blot, ELISA
05-010 Inquire

HIV-1 Gag p55, active as HIV-1 protease substrate, SDS-PAGE, WB, Dot Blot, ELISA

Sign In for Pricing
View Details
Anti-Dickkopf-related protein 1 DKK1 Antibody Picoband®, APC Conjugate
PA1462-APC 100 µg/Vial

Anti-Dickkopf-related protein 1 DKK1 Antibody Picoband®, APC Conjugate

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Ras-related protein RABF2b (RABF2B)
MBS1309475-01 0.02 mg (E-Coli)

Recombinant Arabidopsis thaliana Ras-related protein RABF2b (RABF2B)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Ras-related protein RABF2b (RABF2B)
MBS1309475-02 0.1 mg (E-Coli)

Recombinant Arabidopsis thaliana Ras-related protein RABF2b (RABF2B)

Sign In for Pricing
View Details