Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human KITLG protein

This Human KITLG protein spans the amino acid sequence from region 26-189aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Kit Ligand; Mast Cell Growth Factor; MGF; Stem Cell Factor; SCF; c-Kit ligand; KITLG; MGF; SCF

UniProt

P21583

Expression Region

26-189aa

Tag

Tag-Free

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined in a cell proliferation assay using TF‐1 human erythroleukemic cells is 1-5 ng/ml.

Form

Lyophilized powder

Molecular Weight

18.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.0

AA Sequence

EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIAS1 (Protein Inhibitor of Activated STAT 1) Guinea Pig ELISA Kit
F8840 96 Tests

PIAS1 (Protein Inhibitor of Activated STAT 1) Guinea Pig ELISA Kit

Sign In for Pricing
View Details
HUS1, CT (HUS1, Checkpoint protein HUS1) (Azide free) (HRP) discontinued
036842-HRP 200 µL

HUS1, CT (HUS1, Checkpoint protein HUS1) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
Anti-PAR2/F2RL1 Antibody Picoband® Fluoro550 Conjugated
PB9700-Fluoro550 100 µg/Vial

Anti-PAR2/F2RL1 Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details
IIGP5 Polyclonal Antibody
MBS8529565-01 0.1 mg

IIGP5 Polyclonal Antibody

Sign In for Pricing
View Details
IIGP5 Polyclonal Antibody
MBS8529565-02 0.1 mL (AF635)

IIGP5 Polyclonal Antibody

Sign In for Pricing
View Details
IIGP5 Polyclonal Antibody
MBS8529565-03 0.1 mL (AF610)

IIGP5 Polyclonal Antibody

Sign In for Pricing
View Details