Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Csf2 protein

This Mouse Csf2 protein spans the amino acid sequence from region 18-141aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Granulocyte-macrophage colony-stimulating factor; Csf2; GM-CSF; Colony-stimulating factor; Csfgm

UniProt

P01587

Expression Region

18-141aa

Tag

Tag-Free

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined in a cell proliferation assay using PDC-P1 cells is 15-50 pg/ml.

Form

Lyophilized powder

Molecular Weight

14.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4

AA Sequence

APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPGQK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey Activating Transcription Factor 3 ELISA Kit
MBS019197-01 48 Well

Monkey Activating Transcription Factor 3 ELISA Kit

Sign In for Pricing
View Details
Monkey Activating Transcription Factor 3 ELISA Kit
MBS019197-02 96 Well

Monkey Activating Transcription Factor 3 ELISA Kit

Sign In for Pricing
View Details
Monkey Activating Transcription Factor 3 ELISA Kit
MBS019197-03 5x 96 Well

Monkey Activating Transcription Factor 3 ELISA Kit

Sign In for Pricing
View Details
Monkey Activating Transcription Factor 3 ELISA Kit
MBS019197-04 10x 96 Well

Monkey Activating Transcription Factor 3 ELISA Kit

Sign In for Pricing
View Details
SYNJ2BP Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
45978061 1.0 µg DNA

SYNJ2BP Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
PRAMEF6 Protein Lysate (Mouse) with C-HA Tag
37545034 100 µg

PRAMEF6 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details