Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Csf2 protein

This Mouse Csf2 protein spans the amino acid sequence from region 18-141aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Granulocyte-Macrophage Colony-Stimulating Factor; GM-CSF; Colony-Stimulating Factor; CSF; Molgramostin; Sargramostim; CSF2; GMCSF

UniProt

P01587

Expression Region

18-141aa

Tag

C-terminal 6xHis-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined in a cell proliferation assay using PDC-P1 cells is 40-170 pg/ml.

Form

Lyophilized powder

Molecular Weight

15.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4

AA Sequence

APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPGQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC Anti-Mouse CD14 Antibody[Sa14-2]
E-AB-F1176C-01 50 Tests

FITC Anti-Mouse CD14 Antibody[Sa14-2]

Sign In for Pricing
View Details
FITC Anti-Mouse CD14 Antibody[Sa14-2]
E-AB-F1176C-02 100 Tests

FITC Anti-Mouse CD14 Antibody[Sa14-2]

Sign In for Pricing
View Details
FITC Anti-Mouse CD14 Antibody[Sa14-2]
E-AB-F1176C-03 2x 100 Tests

FITC Anti-Mouse CD14 Antibody[Sa14-2]

Sign In for Pricing
View Details
Chlorodibromoacetic Acid
TRC-C371038-250MG 250 mg

Chlorodibromoacetic Acid

Sign In for Pricing
View Details
Human IgG Immunoglobulin (B33/20), CF405S conjugate, 0.1mg/mL
BNC040952-100 1x 100 µL

Human IgG Immunoglobulin (B33/20), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Benchtop Low Speed Centrifuge BCBL-203
BCBL-203 1 Unit

Benchtop Low Speed Centrifuge BCBL-203

Sign In for Pricing
View Details