Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CSF3 protein

This Human CSF3 protein spans the amino acid sequence from region 31-204aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Granulocyte Colony-Stimulating Factor; G-CSF; Pluripoietin; Filgrastim; Lenograstim; CSF3; C17orf33; GCSF

UniProt

P09919

Expression Region

31-204aa

Tag

Tag-Free

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined in a cell proliferation assay using NFS-60 mouse myelogenous leukemia lymphoblast cells is 0.03 ng/ml.

Form

Lyophilized powder

Molecular Weight

18.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial of Isoform 2

Preservative

Lyophilized from a 0.2 μm filtered 10 mM HAc-NaAc, 150 mM NaCl, 0.004% Tween 80, 5% Mannitol, pH 4.0

AA Sequence

TPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MEFV (Mediterranean Fever, FMF, MEF, MGC126560, MGC126586, TRIM20) (APC)
MBS6169502-01 0.1 mL

MEFV (Mediterranean Fever, FMF, MEF, MGC126560, MGC126586, TRIM20) (APC)

Sign In for Pricing
View Details
MEFV (Mediterranean Fever, FMF, MEF, MGC126560, MGC126586, TRIM20) (APC)
MBS6169502-02 5x 0.1 mL

MEFV (Mediterranean Fever, FMF, MEF, MGC126560, MGC126586, TRIM20) (APC)

Sign In for Pricing
View Details
Iodixanol Impurity 24
RM-I042424-01 10 mg

Iodixanol Impurity 24

Sign In for Pricing
View Details
Iodixanol Impurity 24
RM-I042424-02 100 mg

Iodixanol Impurity 24

Sign In for Pricing
View Details
Iodixanol Impurity 24
RM-I042424-03 25 mg

Iodixanol Impurity 24

Sign In for Pricing
View Details
Iodixanol Impurity 24
RM-I042424-04 50 mg

Iodixanol Impurity 24

Sign In for Pricing
View Details