Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CSF1 protein

This Human CSF1 protein spans the amino acid sequence from region 33-255aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Macrophage Colony-Stimulating Factor 1; CSF-1; M-CSF; MCSF; Lanimostim; CSF1

UniProt

P09603

Expression Region

33-255aa

Tag

C-terminal 6xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined in a cell proliferation assay using M‐NFS‐60 mouse myelogenous leukemia lymphoblast cells is less than 4.16 ng/ml.

Form

Lyophilized powder

Molecular Weight

26.17 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.2

AA Sequence

EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQDVVTKPDCNCLYPKAIPSSDPASVSPHQPLAPSMAPVAGLTWEDSEGTEGSSLLPGEQPLHTVDPGSAKQRPPR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OTX2 Anitbody
E45R12639G-1 100 µL

OTX2 Anitbody

Sign In for Pricing
View Details
Ubiquitin carboxyl-terminal hydrolase 22 (USP22) Human ELISA Kit
I0103 96 Tests

Ubiquitin carboxyl-terminal hydrolase 22 (USP22) Human ELISA Kit

Sign In for Pricing
View Details
Rat Relaxin-3 ELISA Kit
MBS9425321-01 96 Tests

Rat Relaxin-3 ELISA Kit

Sign In for Pricing
View Details
Rat Relaxin-3 ELISA Kit
MBS9425321-02 5x 96 Tests

Rat Relaxin-3 ELISA Kit

Sign In for Pricing
View Details
Human Anoctamin 1 (ANO1) ELISA Kit
YLA1186HU-01 48 Tests

Human Anoctamin 1 (ANO1) ELISA Kit

Sign In for Pricing
View Details
Human Anoctamin 1 (ANO1) ELISA Kit
YLA1186HU-02 96 Tests

Human Anoctamin 1 (ANO1) ELISA Kit

Sign In for Pricing
View Details