Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Primate Fibroblast growth factor protein

This Primate Fibroblast growth factor protein spans the amino acid sequence from region 29-209aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

FGF

UniProt

G3QFY8

Expression Region

29-209aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Gorilla gorilla gorilla (Western lowland gorilla)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPAPPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TM4SF20 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
46797124 3x 1.0µg DNA

TM4SF20 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
MEP1A Protein Vector (Rat) (pPM-C-His)
PV281849 500 ng

MEP1A Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Mouse Olfactory receptor 8I2 (OR8I2) ELISA Kit
GTR10360635 96 Well

Mouse Olfactory receptor 8I2 (OR8I2) ELISA Kit

Sign In for Pricing
View Details
C9orf167-set siRNA/shRNA/RNAi Lentivector (Human)
53894091 4x 500 ng

C9orf167-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Rac- (3R,4S) -4-Hydroxyoxane-3-carbonitrile
EBD12123-01 50 mg

Rac- (3R,4S) -4-Hydroxyoxane-3-carbonitrile

Sign In for Pricing
View Details
Rac- (3R,4S) -4-Hydroxyoxane-3-carbonitrile
EBD12123-02 0.5 g

Rac- (3R,4S) -4-Hydroxyoxane-3-carbonitrile

Sign In for Pricing
View Details