What is the catalog number for Primate Fibroblast growth factor protein?

The catalog number for Primate Fibroblast growth factor protein is orb595189.

What sizes are available for Primate Fibroblast growth factor protein?

Primate Fibroblast growth factor protein is available in the following size(s): 20 µg, 100 µg.

How many pack sizes does Primate Fibroblast growth factor protein come in?

Primate Fibroblast growth factor protein is available in 2 different pack sizes.

Is Primate Fibroblast growth factor protein in stock?

Primate Fibroblast growth factor protein is currently made to order / not held in immediate stock. Contact us for lead time.

Primate Fibroblast growth factor protein

This Primate Fibroblast growth factor protein spans the amino acid sequence from region 29-209aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

FGF

UniProt

G3QFY8

Expression Region

29-209aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Gorilla gorilla gorilla (Western lowland gorilla)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPAPPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS