Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Pld3 protein

This Mouse Pld3 protein spans the amino acid sequence from region 1-488aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Choline phosphatase 3 (Phosphatidylcholine-hydrolyzing phospholipase D3) (Schwannoma-associated protein 9) (SAM-9) (Sam9) (PLD 3)

UniProt

O35405

Expression Region

1-488aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

58.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKPKLMYQELKVPVEEPAGELPLNEIEAWKAAEKKARWVLLVLILAVVGFGALMTQLFLWEYGDLHLFGPNQRPAPCYDPCEAVLVESIPEGLEFPNATTSNPSTSQAWLGLLAGAHSSLDIASFYWTLTNNDTHTQEPSAQQGEEVLQQLQALAPRGVKVRIAVSKPNGPLADLQSLLQSGAQVRMVDMQKLTHGVLHTKFWVVDQTHFYLGSANMDWRSLTQVKELGVVMYNCSCLARDLTKIFEAYWFLGQAGSSIPSTWPRSFDTRYNQETPMEICLNGTPALAYLASAPPPLCPSGRTPDLKALLNVVDSARSFIYIAVMNYLPTMEFSHPRRFWPAIDDGLRRAAYERGVKVRLLISCWGHSDPSMRSFLLSLAALHDNHTHSDIQVKLFVVPTDESQARIPYARVNHNKYMVTERASYIGTSNWSGSYFTETAGTSLLVTQNGHGGLRSQLEAVFLRDWESPYSHDLDTSANSVGNACRLL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MYO1A Human shRNA Plasmid Kit (Locus ID 4640)
TL311300 1 Kit

MYO1A Human shRNA Plasmid Kit (Locus ID 4640)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Interferon Gamma (IFNg)
TRV-0021497-01 100 µL

FITC-Linked Polyclonal Antibody to Interferon Gamma (IFNg)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Interferon Gamma (IFNg)
TRV-0021497-02 200 µL

FITC-Linked Polyclonal Antibody to Interferon Gamma (IFNg)

Sign In for Pricing
View Details
Maltotetraose
S9195-1mg 1 mg

Maltotetraose

Sign In for Pricing
View Details
Recombinant Pseudomonas aeruginosa Succinyl-CoA ligase [ADP-forming] subunit beta (sucC)
MBS1076590-01 0.02 mg (E-Coli)

Recombinant Pseudomonas aeruginosa Succinyl-CoA ligase [ADP-forming] subunit beta (sucC)

Sign In for Pricing
View Details
Recombinant Pseudomonas aeruginosa Succinyl-CoA ligase [ADP-forming] subunit beta (sucC)
MBS1076590-02 0.02 mg (Yeast)

Recombinant Pseudomonas aeruginosa Succinyl-CoA ligase [ADP-forming] subunit beta (sucC)

Sign In for Pricing
View Details