Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Prostaglandin E synthase protein

This Mouse Prostaglandin E synthase protein spans the amino acid sequence from region 1-153aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Microsomal prostaglandin E synthase 1 (mPGES-1) (Pges)

UniProt

Q9JM51

Expression Region

1-153aa

Tag

N-terminal 10xHis-SUMO-tagged

Source

In vitro E.coli expression system

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPSPGLVMESGQVLPAFLLCSTLLVIKMYAVAVITGQMRLRKKAFANPEDALKRGGLQYYRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPLIAWIHFLVVLTGRVVHTVAYLGKLNPRLRSGAYVLAQFSCFSMALQILWEVAHHL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NS5ATP9 Rabbit pAb, AP conjugated
orb2820110 100 µL

NS5ATP9 Rabbit pAb, AP conjugated

Sign In for Pricing
View Details
anti-ZNF567
YF-PA22562 50 ul

anti-ZNF567

Sign In for Pricing
View Details
Olfr399 3'UTR Luciferase Stable Cell Line
TU115183 1.0 mL

Olfr399 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
mPEG-PLA (10K), 5K
MF001184-5K Inquire

mPEG-PLA (10K), 5K

Sign In for Pricing
View Details
Human Aortic Endothelial (Primary cell immortalization) Cell Complete Medium
CM-H080Y-01 100 mL

Human Aortic Endothelial (Primary cell immortalization) Cell Complete Medium

Sign In for Pricing
View Details
Human Aortic Endothelial (Primary cell immortalization) Cell Complete Medium
CM-H080Y-02 4x 125 mL

Human Aortic Endothelial (Primary cell immortalization) Cell Complete Medium

Sign In for Pricing
View Details