Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Prostaglandin E synthase protein

This Mouse Prostaglandin E synthase protein spans the amino acid sequence from region 1-153aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Microsomal prostaglandin E synthase 1 (mPGES-1) (Pges)

UniProt

Q9JM51

Expression Region

1-153aa

Tag

N-terminal 10xHis-SUMO-tagged

Source

In vitro E.coli expression system

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPSPGLVMESGQVLPAFLLCSTLLVIKMYAVAVITGQMRLRKKAFANPEDALKRGGLQYYRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPLIAWIHFLVVLTGRVVHTVAYLGKLNPRLRSGAYVLAQFSCFSMALQILWEVAHHL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

C19orf57 Rabbit Polyclonal Antibody (Cy5.5)
orb1062994 100 µL

C19orf57 Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details
Phospho-eIF4EBP1 (Thr36) Rabbit Polyclonal Antibody (APC-Cy7)
orb2400744 100 µL

Phospho-eIF4EBP1 (Thr36) Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
SLC25A34 Rabbit Polyclonal Antibody (PE)
orb491369 100 µL

SLC25A34 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli (strain K12) RHLB Polyclonal Antibody
MBS7165270 Inquire

Rabbit anti-Escherichia coli (strain K12) RHLB Polyclonal Antibody

Sign In for Pricing
View Details
C19orf70 CRISPR Knock Out 293T Cell Line (Human)
14092141 1x 10^6 Cells / 1.0 mL

C19orf70 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Human Osteopontin/OPN, C-His Tag
HA210993-01 Inquire

Human Osteopontin/OPN, C-His Tag

Sign In for Pricing
View Details