Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Prostaglandin E synthase protein

This Mouse Prostaglandin E synthase protein spans the amino acid sequence from region 1-153aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Microsomal prostaglandin E synthase 1 (mPGES-1) (Pges)

UniProt

Q9JM51

Expression Region

1-153aa

Tag

N-terminal 10xHis-SUMO-tagged

Source

In vitro E.coli expression system

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPSPGLVMESGQVLPAFLLCSTLLVIKMYAVAVITGQMRLRKKAFANPEDALKRGGLQYYRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPLIAWIHFLVVLTGRVVHTVAYLGKLNPRLRSGAYVLAQFSCFSMALQILWEVAHHL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR51A9P Protein Vector (Human) (pPM-C-HA)
35279021 500 ng

OR51A9P Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
ISLR Rabbit pAb, PE-Cy5 conjugated
orb2858578 100 µL

ISLR Rabbit pAb, PE-Cy5 conjugated

Sign In for Pricing
View Details
MRP1 (ABCC1) Rabbit Polyclonal Antibody
TA322683 100 µL

MRP1 (ABCC1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
pCMV-GALNT7-Myc-SV40-Neo Plasmid
PVT43950 2 µg

pCMV-GALNT7-Myc-SV40-Neo Plasmid

Sign In for Pricing
View Details
Rabbit Anti-Human DYNC2LI1 pAb
PA13809-01 50 μL

Rabbit Anti-Human DYNC2LI1 pAb

Sign In for Pricing
View Details
Rabbit Anti-Human DYNC2LI1 pAb
PA13809-02 100 μL

Rabbit Anti-Human DYNC2LI1 pAb

Sign In for Pricing
View Details