Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PSENEN protein

This Human PSENEN protein spans the amino acid sequence from region 1-101aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Presenilin enhancer protein 2 (PEN2)

UniProt

Q9NZ42

Expression Region

1-101aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MNLERVSNEEKLNLCRKYYLGGFAFLPFLWLVNIFWFFREAFLVPAYTEQSQIKGYVWRSAVGFLFWVIVLTSWITIFQIYRPRWGALGDYLSFTIPLGTP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FN1 | Fibronectin Rabbit pAb, PE-Cy5.5 conjugated
orb3126041 100 µL

FN1 | Fibronectin Rabbit pAb, PE-Cy5.5 conjugated

Sign In for Pricing
View Details
Integrin alpha 1/ITGA1 Rabbit Polyclonal Antibody (Fluoro647)
orb3083906 100 µg

Integrin alpha 1/ITGA1 Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details
Anti SARS-CoV-2 Nucleocapsid rabbit mAb (Clone: 84C4a)
12-4002-200 200 μL (mg/mL)

Anti SARS-CoV-2 Nucleocapsid rabbit mAb (Clone: 84C4a)

Sign In for Pricing
View Details
Human TESPA1 (Protein TESPA1) ELISA Kit
orb1715173-01 48 Tests

Human TESPA1 (Protein TESPA1) ELISA Kit

Sign In for Pricing
View Details
Human TESPA1 (Protein TESPA1) ELISA Kit
orb1715173-02 96 Tests

Human TESPA1 (Protein TESPA1) ELISA Kit

Sign In for Pricing
View Details
Human RPS4Y1 activation kit by CRISPRa
GA104194 1 Kit

Human RPS4Y1 activation kit by CRISPRa

Sign In for Pricing
View Details