Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus Ba71V-107 protein

This Virus Ba71V-107 protein spans the amino acid sequence from region 1-117aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ba71V-107, D117L, Major structural protein p17

UniProt

Q89424

Expression Region

1-117aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

African swine fever virus (strain Badajoz 1971 Vero-adapted) (Ba71V) (ASFV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDTETSPLLSHNLSTREGIKQSTQGLLAHTIARYPGTTAILLGILILLVIILIIVAIVYYNRSVDCKSSMPKPPPSYYVQQPEPHHHFPVFFRKRKNSTSLQSHIPSDEQLAELAHS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ddx3x Mouse Gene Knockout Kit (CRISPR)
KN304393BN 1 Kit

Ddx3x Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
OR2T10 Human Gene Knockout Kit (CRISPR)
KN422525 1 Kit

OR2T10 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
JAM2 Polyclonal Antibody
E-AB-90742-01 60 µL

JAM2 Polyclonal Antibody

Sign In for Pricing
View Details
JAM2 Polyclonal Antibody
E-AB-90742-02 120 µL

JAM2 Polyclonal Antibody

Sign In for Pricing
View Details
JAM2 Polyclonal Antibody
E-AB-90742-03 200 µL

JAM2 Polyclonal Antibody

Sign In for Pricing
View Details
Bcl-X (Apoptosis Marker) (BCL2L1/2406), CF405S conjugate, 0.1mg/mL
BNC042406-500 1x 500 µL

Bcl-X (Apoptosis Marker) (BCL2L1/2406), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details