Virus Ba71V-107 protein
This Virus Ba71V-107 protein spans the amino acid sequence from region 1-117aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Ba71V-107, D117L, Major structural protein p17
UniProt
Q89424
Expression Region
1-117aa
Tag
N-terminal 10xHis-tagged
Source
In vitro E.coli expression system
Origin
African swine fever virus (strain Badajoz 1971 Vero-adapted) (Ba71V) (ASFV)
Field of Research
Infectious Disease & Virology
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
19.2 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Full Length
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MDTETSPLLSHNLSTREGIKQSTQGLLAHTIARYPGTTAILLGILILLVIILIIVAIVYYNRSVDCKSSMPKPPPSYYVQQPEPHHHFPVFFRKRKNSTSLQSHIPSDEQLAELAHS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
RAF-462-1 1 mL
TRITC Conjugated Goat Affinity Purified Antibody to Rat IgG (min.x Hu., Bov., Eq.)
Sign In for Pricing
View Details 
BNC470172-500 1x 500 µL
CD45 / LCA (135-4C5), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![CD68 Mouse Monoclonal Antibody [Clone ID: SPM130]](https://cdn.genprice.uk/products/937/68dd189e061270361e8fd7e8/imageurl/am50195pu-s.webp)
AM50195PU-S 100 µg
CD68 Mouse Monoclonal Antibody [Clone ID: SPM130]
Sign In for Pricing
View Details 
TP321884M 100 µg
CK1 epsilon (CSNK1E) (NM_001894) Human Recombinant Protein
Sign In for Pricing
View Details 
