Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Primate FASLG protein

This Primate FASLG protein spans the amino acid sequence from region 102-211aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CD95 ligand (CD95-L) (Fas antigen ligand) (Fas ligand) (FasL) (CD_antigen, CD178) (CD95L) (FASL) (TNFSF6)

UniProt

P63308

Expression Region

102-211aa

Tag

N-terminal 6xHis-tagged

Source

In vitro E.coli expression system

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QLFHLQKELAELRESTSQKHTASSLEKQIGHPSPPPEKKEQRKVAHLTGKPNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCTNLPLSHKVY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Kidney
CS622741 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
Single Beam Visible Spectrophotometer BSSBV-304
BSSBV-304 Each

Single Beam Visible Spectrophotometer BSSBV-304

Sign In for Pricing
View Details
Bax (BAX/962), CF640R conjugate, 0.1mg/mL
BNC400962-500 1x 500 µL

Bax (BAX/962), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Accuris qMAX Green One-Step RT-qPCR Kit, Low Rox, 1000 reactions
PR2120-L-1000 1 Each

Accuris qMAX Green One-Step RT-qPCR Kit, Low Rox, 1000 reactions

Sign In for Pricing
View Details
Amy2b Mouse Gene Knockout Kit (CRISPR)
KN501215 1 Kit

Amy2b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
3,4-Diaminophenol (>80%)
TRC-D416648-500MG 500 mg

3,4-Diaminophenol (>80%)

Sign In for Pricing
View Details