Human P2RY12 protein
This Human P2RY12 protein spans the amino acid sequence from region 1-342aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
ADP-glucose receptor (ADPG-R) (P2T) (P2Y (AC) ) (P2Y (cyc) ) (P2Y12 platelet ADP receptor) (P2Y (ADP) ) (SP1999) (HORK3) (P2Y12)
UniProt
Q9H244
Expression Region
1-342aa
Tag
N-terminal 10xHis-tagged
Source
In vitro E.coli expression system
Origin
Homo sapiens (Human)
Field of Research
Cardiovascular Research
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
42.2 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Full Length
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MQAVDNLTSAPGNTSLCTRDYKITQVLFPLLYTVLFFVGLITNGLAMRIFFQIRSKSNFIIFLKNTVISDLLMILTFPFKILSDAKLGTGPLRTFVCQVTSVIFYFTMYISISFLGLITIDRYQKTTRPFKTSNPKNLLGAKILSVVIWAFMFLLSLPNMILTNRQPRDKNVKKCSFLKSEFGLVWHEIVNYICQVIFWINFLIVIVCYTLITKELYRSYVRTRGVGKVPRKKVNVKVFIIIAVFFICFVPFHFARIPYTLSQTRDVFDCTAENTLFYVKESTLWLTSLNACLDPFIYFFLCKSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS2079114-01 0.1 mL
Cy3-Linked Polyclonal Antibody to Toll Like Receptor Adaptor Molecule 1 (TICAM1)
Sign In for Pricing
View Details MBS2079114-02 0.2 mL
Cy3-Linked Polyclonal Antibody to Toll Like Receptor Adaptor Molecule 1 (TICAM1)
Sign In for Pricing
View Details MBS2079114-03 0.5 mL
Cy3-Linked Polyclonal Antibody to Toll Like Receptor Adaptor Molecule 1 (TICAM1)
Sign In for Pricing
View Details MBS2079114-04 1 mL
Cy3-Linked Polyclonal Antibody to Toll Like Receptor Adaptor Molecule 1 (TICAM1)
Sign In for Pricing
View Details MBS2079114-05 5 mL
Cy3-Linked Polyclonal Antibody to Toll Like Receptor Adaptor Molecule 1 (TICAM1)
Sign In for Pricing
View Details MBS2079114-06 5x 5 mL
Cy3-Linked Polyclonal Antibody to Toll Like Receptor Adaptor Molecule 1 (TICAM1)
Sign In for Pricing
View Details