Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Apoc1 protein

This Mouse Apoc1 protein spans the amino acid sequence from region 27-88aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Apolipoprotein C1

UniProt

P34928

Expression Region

27-88aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Mus musculus (Mouse)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

12.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APDLSGTLESIPDKLKEFGNTLEDKARAAIEHIKQKEILTKTRAWFSEAFGKVKEKLKTTFS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

mmu-miR-6987-3p miRNA Agomir
MBS8314726-01 5 nmol

mmu-miR-6987-3p miRNA Agomir

Sign In for Pricing
View Details
mmu-miR-6987-3p miRNA Agomir
MBS8314726-02 10 nmol

mmu-miR-6987-3p miRNA Agomir

Sign In for Pricing
View Details
mmu-miR-6987-3p miRNA Agomir
MBS8314726-03 20 nmol

mmu-miR-6987-3p miRNA Agomir

Sign In for Pricing
View Details
mmu-miR-6987-3p miRNA Agomir
MBS8314726-04 5x 20 nmol

mmu-miR-6987-3p miRNA Agomir

Sign In for Pricing
View Details
Bacteria-Derived Collagenase Purified 10ku
IBCTCLSPF10KU 10 KU

Bacteria-Derived Collagenase Purified 10ku

Sign In for Pricing
View Details
OR4A17P Protein Vector (Human) (pPM-C-His)
PV106845 500 ng

OR4A17P Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details