Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Apoc1 protein

This Mouse Apoc1 protein spans the amino acid sequence from region 27-88aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Apolipoprotein C1

UniProt

P34928

Expression Region

27-88aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Mus musculus (Mouse)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

12.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APDLSGTLESIPDKLKEFGNTLEDKARAAIEHIKQKEILTKTRAWFSEAFGKVKEKLKTTFS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mercurous Nitrate 98% AR
168200250 250 mg

Mercurous Nitrate 98% AR

Sign In for Pricing
View Details
Bpifa1 Protein Vector (Rat) (pPB-C-His)
PV256478 500 ng

Bpifa1 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
ZNF274 (Zinc Finger Protein 274, Neurotrophin Receptor-interacting Factor Homolog, Zf2, Zinc Finger Protein HFB101, Zinc Finger Protein with KRAB and SCAN Domains 19, Zinc Finger Protein zfp2, HFB101, SP2114, ZKSCAN19, ZSCAN51) (MaxLight 650)
135669-ML650 100 µL

ZNF274 (Zinc Finger Protein 274, Neurotrophin Receptor-interacting Factor Homolog, Zf2, Zinc Finger Protein HFB101, Zinc Finger Protein with KRAB and SCAN Domains 19, Zinc Finger Protein zfp2, HFB101, SP2114, ZKSCAN19, ZSCAN51) (MaxLight 650)

Sign In for Pricing
View Details
Human MIP3a ELISA Kit
orb440793-01 48 Tests

Human MIP3a ELISA Kit

Sign In for Pricing
View Details
Human MIP3a ELISA Kit
orb440793-02 96 Tests

Human MIP3a ELISA Kit

Sign In for Pricing
View Details
Mal-Pc
T75000-01 5 mg

Mal-Pc

Sign In for Pricing
View Details