Mouse Apoc1 protein
This Mouse Apoc1 protein spans the amino acid sequence from region 27-88aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Apolipoprotein C1
UniProt
P34928
Expression Region
27-88aa
Tag
N-terminal 10xHis-tagged
Source
In vitro E.coli expression system
Origin
Mus musculus (Mouse)
Field of Research
Cardiovascular Research
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
12.5 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Full Length of Mature Protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
APDLSGTLESIPDKLKEFGNTLEDKARAAIEHIKQKEILTKTRAWFSEAFGKVKEKLKTTFS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS7236044-01 48 Well
Mouse Transmembrane protein 41B (TMEM41B) ELISA Kit
Sign In for Pricing
View Details MBS7236044-02 96 Well
Mouse Transmembrane protein 41B (TMEM41B) ELISA Kit
Sign In for Pricing
View Details MBS7236044-03 5x 96 Well
Mouse Transmembrane protein 41B (TMEM41B) ELISA Kit
Sign In for Pricing
View Details MBS7236044-04 10x 96 Well
Mouse Transmembrane protein 41B (TMEM41B) ELISA Kit
Sign In for Pricing
View Details 
126531-ML490 100 µL
EZR (Ezrin, Cytovillin, Villin-2, p81, VIL2, CVIL, CVL, DKFZp762H157, FLJ26216, MGC1584) (MaxLight 490)
Sign In for Pricing
View Details 
MBS1601138-01 48 Well
Mouse Retinoic acid receptor gamma (RARG) ELISA Kit
Sign In for Pricing
View Details