Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Pmp22 protein

This Rat Pmp22 protein spans the amino acid sequence from region 1-160aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein CD25 (SR13 myelin protein) (Schwann cell membrane glycoprotein) (SAG) (Cd25) (Pmp-22)

UniProt

P25094

Expression Region

1-160aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Rattus norvegicus (Rat)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MLLLLLGILFLHIAVLVLLFVSTIVSQWLVGNGHRTDLWQNCTTSALGAVQHCYSSSVSEWLQSVQATMILSVIFSVLSLFLFFCQLFTLTKGGRFYITGVFQILAGLCVMSAAAIYTVRHSEWHVNNDYSYGFAYILAWVAFPLALLSGIIYVILRKRE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HIP14; ZDHHC17 discontinued
510232 100 µg

HIP14; ZDHHC17 discontinued

Sign In for Pricing
View Details
MCP-1 monoclonal antibody (E10052) (biotin conjugate)
ENZ-ABS281-0100 100 µg

MCP-1 monoclonal antibody (E10052) (biotin conjugate)

Sign In for Pricing
View Details
hsa-miR-154 miRNA Antagomir
MNH01363 2x 5.0 nmol

hsa-miR-154 miRNA Antagomir

Sign In for Pricing
View Details
Crocusatin R
M39657-01 100 mg

Crocusatin R

Sign In for Pricing
View Details
Crocusatin R
M39657-02 25 mg

Crocusatin R

Sign In for Pricing
View Details
Crocusatin R
M39657-03 50 mg

Crocusatin R

Sign In for Pricing
View Details