Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Pmp22 protein

This Rat Pmp22 protein spans the amino acid sequence from region 1-160aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein CD25 (SR13 myelin protein) (Schwann cell membrane glycoprotein) (SAG) (Cd25) (Pmp-22)

UniProt

P25094

Expression Region

1-160aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Rattus norvegicus (Rat)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MLLLLLGILFLHIAVLVLLFVSTIVSQWLVGNGHRTDLWQNCTTSALGAVQHCYSSSVSEWLQSVQATMILSVIFSVLSLFLFFCQLFTLTKGGRFYITGVFQILAGLCVMSAAAIYTVRHSEWHVNNDYSYGFAYILAWVAFPLALLSGIIYVILRKRE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DPEP2 Rabbit Polyclonal Antibody (PE-Cy5.5)
orb943298 100 µL

DPEP2 Rabbit Polyclonal Antibody (PE-Cy5.5)

Sign In for Pricing
View Details
BEX3 Rabbit Polyclonal Antibody (Fluoro550)
orb3097154 100 µg

BEX3 Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
Dimethyl 3,3′-dithiopropionimidate dihydrochloride
TYD-01759-01 100 mg

Dimethyl 3,3′-dithiopropionimidate dihydrochloride

Sign In for Pricing
View Details
Dimethyl 3,3′-dithiopropionimidate dihydrochloride
TYD-01759-02 250 mg

Dimethyl 3,3′-dithiopropionimidate dihydrochloride

Sign In for Pricing
View Details
Dimethyl 3,3′-dithiopropionimidate dihydrochloride
TYD-01759-03 50 mg

Dimethyl 3,3′-dithiopropionimidate dihydrochloride

Sign In for Pricing
View Details
OTX1 + OTX2 Rabbit Polyclonal Antibody (RBITC)
orb1011668 100 µL

OTX1 + OTX2 Rabbit Polyclonal Antibody (RBITC)

Sign In for Pricing
View Details