Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human COL6A3 protein

This Human COL6A3 protein spans the amino acid sequence from region 2853-3176aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CO6A3_HUMAN, COL6A3, Collagen alpha-3 (VI) chain, Collagen type VI alpha 3, Collagen VI alpha 3

UniProt

P12111

Expression Region

2853-3176aa

Tag

N-terminal 6xHis-B2M-tagged

Source

In vitro E.coli expression system

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

48.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HKQVNVPNNVTSSPTSNPVTTTKPVTTTKPVTTTTKPVTTTTKPVTIINQPSVKPAAAKPAPAKPVAAKPVATKMATVRPPVAVKPATAAKPVAAKPAAVRPPAAAAAKPVATKPEVPRPQAAKPAATKPATTKPMVKMSREVQVFEITENSAKLHWERAEPPGPYFYDLTVTSAHDQSLVLKQNLTVTDRVIGGLLAGQTYHVAVVCYLRSQVRATYHGSFSTKKSQPPPPQPARSASSSTINLMVSTEPLALTETDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCAPVLAKPGVISVMG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TBK1/NAK (D1B4) Rabbit Monoclonal Antibody (Biotinylated)
CST 33960S 100 µL

TBK1/NAK (D1B4) Rabbit Monoclonal Antibody (Biotinylated)

Sign In for Pricing
View Details
Rabbit anti-DYNC1I1 Antibody
MBS4510551-01 0.05 mL

Rabbit anti-DYNC1I1 Antibody

Sign In for Pricing
View Details
Rabbit anti-DYNC1I1 Antibody
MBS4510551-02 0.1 mL

Rabbit anti-DYNC1I1 Antibody

Sign In for Pricing
View Details
Rabbit anti-DYNC1I1 Antibody
MBS4510551-03 5x 0.1 mL

Rabbit anti-DYNC1I1 Antibody

Sign In for Pricing
View Details
BC051142 Double Nickase Plasmid (m)
sc-436568-NIC 20 µg

BC051142 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
Vom2r65 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV648156 1.0 µg DNA

Vom2r65 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details