Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus Gorilla gorilla gorilla Fibroblast growth factor protein

This Virus Gorilla gorilla gorilla Fibroblast growth factor protein spans the amino acid sequence from region 52-175aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

NCVP5 NS28

UniProt

Q9PYC8

Expression Region

52-175aa

Tag

N-terminal 6xHis-tagged and C-terminal Myc-tagged

Source

In vitro E.coli expression system

Origin

Rotavirus A (isolate RVA/Cow/United States/B223/1983/G10P8[11 ]) (RV-A)

Field of Research

Infectious Disease & Virology; Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Cytoplasmic Domain

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMERVVKEMRRHFKMIDKLTTREIEQVGLLKRIHDKLDIRAVDEIDMTKEINQKNVRTLEEWEWGKNPYEPKEVTAAM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2'-OMe-U (Bz) -CE-Phosphoramidite
orb3180985-01 50 mg

2'-OMe-U (Bz) -CE-Phosphoramidite

Sign In for Pricing
View Details
2'-OMe-U (Bz) -CE-Phosphoramidite
orb3180985-02 10 mg

2'-OMe-U (Bz) -CE-Phosphoramidite

Sign In for Pricing
View Details
Rabbit DNM1 ELISA Kit
ERTD0254 96 Tests

Rabbit DNM1 ELISA Kit

Sign In for Pricing
View Details
Caspase-1 Peptide
3463P 0.05 mg

Caspase-1 Peptide

Sign In for Pricing
View Details
ABC3735 Goat Polyclonal Antibody
R1118 2 mL

ABC3735 Goat Polyclonal Antibody

Sign In for Pricing
View Details
LentimiRa-hsa-miR-3688-5p Vector
mh41792 500 ng

LentimiRa-hsa-miR-3688-5p Vector

Sign In for Pricing
View Details