Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus Gorilla gorilla gorilla Fibroblast growth factor protein

This Virus Gorilla gorilla gorilla Fibroblast growth factor protein spans the amino acid sequence from region 52-175aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

NCVP5 NS28

UniProt

Q9PYC8

Expression Region

52-175aa

Tag

N-terminal 6xHis-tagged and C-terminal Myc-tagged

Source

In vitro E.coli expression system

Origin

Rotavirus A (isolate RVA/Cow/United States/B223/1983/G10P8[11 ]) (RV-A)

Field of Research

Infectious Disease & Virology; Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Cytoplasmic Domain

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMERVVKEMRRHFKMIDKLTTREIEQVGLLKRIHDKLDIRAVDEIDMTKEINQKNVRTLEEWEWGKNPYEPKEVTAAM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-AGTR2 Antibody (5P814)
TMAC-00207-01 50 μL

Anti-AGTR2 Antibody (5P814)

Sign In for Pricing
View Details
Anti-AGTR2 Antibody (5P814)
TMAC-00207-02 100 µL

Anti-AGTR2 Antibody (5P814)

Sign In for Pricing
View Details
Chicken Mediator of RNA polymerase II transcription subunit 17 (MED17) ELISA kit
GTR10419182 96 Well

Chicken Mediator of RNA polymerase II transcription subunit 17 (MED17) ELISA kit

Sign In for Pricing
View Details
PCPE-1 Lentiviral Activation Particles (m2)
sc-422136-LAC-2 200 µL

PCPE-1 Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
Elisa Synblock
orb436756 500 mL

Elisa Synblock

Sign In for Pricing
View Details
Rabbit Anti-JNK1/JNK2/JNK3 monoclonal antibody, clone TB54-17
CABT-L570 100 ul

Rabbit Anti-JNK1/JNK2/JNK3 monoclonal antibody, clone TB54-17

Sign In for Pricing
View Details