Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus PS/HR protein

This Virus PS/HR protein spans the amino acid sequence from region 17-279aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein B5

UniProt

P24083

Expression Region

17-279aa

Tag

N-terminal 6xHis-tagged

Source

In vitro E.coli expression system

Origin

Vaccinia virus (strain Lister) (VACV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VYSTCTVPTMNNAKLTSTETSFNDKQKVTFTCDQGYHSSDPNAVCETDKWKYENPCKKMCTVSDYVSELYDKPLYEVNSTMTLSCNGETKYFRCEEKNGNTSWNDTVTCPNAECQPLQLEHGSCQPVKEKYSFGEYITINCDVGYEVIGASYISCTANSWNVIPSCQQKCDMPSLSNGLISGSTFSIGGVIHLSCKSGFTLTGSPSSTCIDGKWNPILPTCVRSNEKFDPVDDGPDDETDLSKLSKDVVQYEQEIESLEATYH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Carnosine ELISA Kit
MBS756185-01 48 Well

Canine Carnosine ELISA Kit

Sign In for Pricing
View Details
Canine Carnosine ELISA Kit
MBS756185-02 96 Well

Canine Carnosine ELISA Kit

Sign In for Pricing
View Details
Canine Carnosine ELISA Kit
MBS756185-03 5x 96 Well

Canine Carnosine ELISA Kit

Sign In for Pricing
View Details
Canine Carnosine ELISA Kit
MBS756185-04 10x 96 Well

Canine Carnosine ELISA Kit

Sign In for Pricing
View Details
APC anti-human CD13
MBS9471231-01 25 Tests

APC anti-human CD13

Sign In for Pricing
View Details
APC anti-human CD13
MBS9471231-02 100 Tests

APC anti-human CD13

Sign In for Pricing
View Details